SMART: Pfam domain Mucin15

The domain within your query sequence starts at position 21 and ends at position 331; the E-value for the Mucin15 domain shown below is 2.3e-155.

RPQKQNPRRNVTQHTIEDVKIMRNNSIHLERSINVTSENGSDISNLMVTTPSPLNLSTTF
RTTNSTRTWLMTSSSESSRPSSTYSVPPLVQGFVSKLPLNSSTADANPLQVSEHSNSTNS
PSPENFTWSLDNDTMNSPEDISTTVRPFPPPPKTTPVTPFTAEPTEWLPTNNDNFAGFTP
YQEKTTLQPTLKFTNNSKLFPNTSDTPKENKNTGIVFGAILGAILGASLLSLVGYLLCGQ
RKTDSFSHRRLYDDRNEPVLRLDNAPEPYDVNFGNSSYYNPAVSDSSMPEGGESLQDGIP
MDAIPPLRPSI

Mucin15

PFAM accession number:	PF15672
Interpro abstract (IPR031371):	Mucins are heavily glycosylated proteins expressed by various epithelial cell types. They can be divided into two classes according to cellular localisation: membrane-bound mucins and secretory mucins. Mucin-15 (MUC15) is a cell membrane-associated mucin. The predicted protein product of human MUC15 contains an extracelluar domain, a small transmembrane domain, and a highly conserved cytoplasmic tail [ (PUBMED:12047385) ]. Mucin-15 is expressed in human placenta and may play a role in the regulation of trophoblast invasion [ (PUBMED:17720698) ].

PFAM accession number:

PF15672

Interpro abstract (IPR031371):

Mucins are heavily glycosylated proteins expressed by various epithelial cell types. They can be divided into two classes according to cellular localisation: membrane-bound mucins and secretory mucins. Mucin-15 (MUC15) is a cell membrane-associated mucin. The predicted protein product of human MUC15 contains an extracelluar domain, a small transmembrane domain, and a highly conserved cytoplasmic tail [ (PUBMED:12047385) ]. Mucin-15 is expressed in human placenta and may play a role in the regulation of trophoblast invasion [ (PUBMED:17720698) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mucin15