The domain within your query sequence starts at position 2687 and ends at position 2776; the E-value for the Mucin2_WxxW domain shown below is 3.8e-25.
TWTDWLDSDKPQPGQFEGDIETYYHIQNKTGIKICKKPVDIECEAVLFPNISFQKLGQEV VCNVDFGLICRNSKQSDNQICFNYHIRVLC
Mucin2_WxxW |
![]() |
---|
PFAM accession number: | PF13330 |
---|---|
Interpro abstract (IPR025155): | This domain of unknown function carries a highly conserved WxxW sequence motif and also has at least six well conserved cysteine residues. It is found in variable numbers ranging from a single copy up to 32 consecutive copies, as in C3Y5K5 from Branchiostoma floridae. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mucin2_WxxW