The domain within your query sequence starts at position 6 and ends at position 85; the E-value for the Myb_DNA-bind_5 domain shown below is 2.2e-24.
RSSNFTLSEKLDLLNLVKPYVKILEEHTNKNSVIVEKNRCWDVIAVNYNAIGVDRPPRTA QGLRSLYKRLKEYAKQELLQ
Myb_DNA-bind_5 |
![]() |
---|
PFAM accession number: | PF13873 |
---|---|
Interpro abstract (IPR028002): | This predicted domain appears to be related to other Myb/SANT like DNA binding domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myb_DNA-bind_5