The domain within your query sequence starts at position 143 and ends at position 214; the E-value for the Myf5 domain shown below is 4.5e-29.

ENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKNSSFDSIYCPDVSNACAADKSSVS
SLDCLSSIVDRI

Myf5

Myf5
PFAM accession number:PF12232
Interpro abstract (IPR022032):

This domain is found in eukaryotes, is approximately 70 amino acids in length, and contains a conserved CSD sequence motif. It is found in association with . This domain is found in Myogenic factor 5 (Myf5) and Myoblast determination protein 1 (MyoD1). Myf5 is responsible for directing cells to the skeletal myocyte lineage during development [ (PUBMED:17395511) ]. Myf5 is likely to act in a similar way to the other MRF4 proteins such as MyoD which perform the same function [ (PUBMED:21798092) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Myf5