The domain within your query sequence starts at position 168 and ends at position 338; the E-value for the N6-adenineMlase domain shown below is 7.1e-11.

THAQYLFADRSCQFLAGLLATLGFSRVLCVGAPRLHEQIRLTASGERSGMRSLLLDIDFR
YSQFYLEGSFCRYNMFNHHFFDGKAALEVCKEFLQEEEGKGVIMVTDPPFGGLVEPLAIT
FKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCMLDYQVDY

N6-adenineMlase

• PFAM accession number: PF10237
• Interpro abstract (IPR041370):

  This is a protein of approximately 200 residues which is conserved from plants to humans [ (PUBMED:7607512) ]. It contains a highly conserved QFW motif close to the N terminus and a DPPF motif in the centre. The DPPF motif is characteristic of N-6 adenine-specific DNA methylases, and this family is found in eukaryotes [ (PUBMED:16479578) ]. Proteins in this entry include EEF1A lysine methyltransferase 1 (EEF1AKMT1) and ZCCHC4. EEF1AKMT1 is a protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79' [ (PUBMED:26545399) ]. ZCCHC4 is an rRNA N6-methyltransferase that specifically methylates the adenine in position 4220 of 28S rRNA [ (PUBMED:30531910) ].

• GO function: methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry N6-adenineMlase