The domain within your query sequence starts at position 36 and ends at position 125; the E-value for the NAAA-beta domain shown below is 1.3e-23.
GTPPLFNVSLDAAPEQRWLPMLRHYDPDFLRTAVAQVIGVPQWVLGMVGEIVSKVESFLP QPFTDEIRSICDSLNLSLADGILVNLAYEA
NAAA-beta |
![]() |
---|
PFAM accession number: | PF15508 |
---|---|
Interpro abstract (IPR029130): | This entry represents the N-terminal domain of acid ceramidase (AC), which degrades ceramide into sphingosine and fatty acid [ (PUBMED:10610716) ], and N-acylethanolamine-hydrolysing acid amidase (NAAA). NAAA is an N-acylethanolamine-hydrolysing enzyme that shows structural and functional similarity to acid ceramidase [ (PUBMED:15655246) ]. AC and NAAA can be cleaved into two chains: alpha and beta [ (PUBMED:18281275) (PUBMED:17980170) ]. This entry represent the beta subunit (chain). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAAA-beta