The domain within your query sequence starts at position 1 and ends at position 110; the E-value for the NAD_Gly3P_dh_C domain shown below is 4.2e-37.
MEMIAFAKIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKELL NGQKLQGPQTSAEVYRILRQKGLLDKFPLFTAVYQICYEGRPVTQMLSCL
NAD_Gly3P_dh_C |
 |
|---|
| PFAM accession number: | PF07479 |
|---|---|
| Interpro abstract (IPR006109): | NAD-dependent glycerol-3-phosphate dehydrogenase ( EC 1.1.1.8 ) (GPD) catalyzes the reversible reduction of dihydroxyacetone phosphate to glycerol-3-phosphate. It is a cytoplasmic protein, active as a homodimer [ (PUBMED:2500660) ], each monomer containing an N-terminal NAD binding site [ (PUBMED:6773774) ]. In insects, it acts in conjunction with a mitochondrial alpha-glycerophosphate oxidase in the alpha-glycerophosphate cycle, which is essential for the production of energy used in insect flight [ (PUBMED:2500660) ]. |
| GO process: | carbohydrate metabolic process (GO:0005975), oxidation-reduction process (GO:0055114) |
| GO function: | glycerol-3-phosphate dehydrogenase [NAD+] activity (GO:0004367) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_Gly3P_dh_C