The domain within your query sequence starts at position 5 and ends at position 77; the E-value for the NAD_Gly3P_dh_N domain shown below is 3.6e-21.

KVCIVGSGNWGSAIAKIVGSNAGRLAHFDPRVTMWVFEEDIGGRKLTEIINTQHENVKYL
PGHKLPPNVFIGK

NAD_Gly3P_dh_N

NAD_Gly3P_dh_N
PFAM accession number:PF01210
Interpro abstract (IPR011128):

NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain [ (PUBMED:10801498) ].

GO process:glycerol-3-phosphate catabolic process (GO:0046168), oxidation-reduction process (GO:0055114)
GO function:NAD binding (GO:0051287), oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_Gly3P_dh_N