The domain within your query sequence starts at position 7 and ends at position 176; the E-value for the NAD_Gly3P_dh_N domain shown below is 3.6e-52.

KVCIVGSGNWGSAVAKIIGSNVKTLQKFSSTVKMWVFEETVNGRKLTDIINNDHENVKYL
PGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHKICDEITGRVPEKALGITLIKGIDE
GPDGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMQNG

NAD_Gly3P_dh_N

NAD_Gly3P_dh_N
PFAM accession number:PF01210
Interpro abstract (IPR011128):

NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain [ (PUBMED:10801498) ].

GO process:oxidation-reduction process (GO:0055114), glycerol-3-phosphate catabolic process (GO:0046168)
GO function:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616), NAD binding (GO:0051287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_Gly3P_dh_N