The domain within your query sequence starts at position 7 and ends at position 176; the E-value for the NAD_Gly3P_dh_N domain shown below is 4.9e-56.
KVCIVGSGNWGSAVAKIIGSNVKTLQKFSSTVKMWVFEETVNGRKLTDIINNDHENVKYL PGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHKICDEITGRVPEKALGITLIKGIDE GPDGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMQNG
NAD_Gly3P_dh_N |
![]() |
---|
PFAM accession number: | PF01210 |
---|---|
Interpro abstract (IPR011128): | NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain [ (PUBMED:10801498) ]. |
GO process: | oxidation-reduction process (GO:0055114), glycerol-3-phosphate catabolic process (GO:0046168) |
GO function: | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616), NAD binding (GO:0051287) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_Gly3P_dh_N