The domain within your query sequence starts at position 399 and ends at position 549; the E-value for the NAD_binding_6 domain shown below is 1e-34.
YPVSVCIATGIGVTPFASLLKSVWYKCCESQSLPELSKVYFYWICRDAGAFEWFADLLLS LETRMSEQGKAHLLSYHIYLTGWDENQAIHIALHWDESLDVITGLKQKAFYGRPNWNDEF KQIAYNHPSSSIGVFFCGSKAMSKTLQKMCR
NAD_binding_6 |
![]() |
---|
PFAM accession number: | PF08030 |
---|---|
Interpro abstract (IPR013121): | This entry contains ferric reductase NAD binding proteins. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_6