The domain within your query sequence starts at position 36 and ends at position 114; the E-value for the NCD1 domain shown below is 1.2e-44.
LPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLH VRRLQKALREWATNPGLFS
NCD1 |
---|
PFAM accession number: | PF04904 |
---|---|
Interpro abstract (IPR006988): | Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [ (PUBMED:9418898) ]. This entry represents the N-terminal NAB domain, which interacts with the EGR1 inhibitory domain (R1) [ (PUBMED:9418898) ]. It may also mediate multimerisation. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | transcription coregulator activity (GO:0003712) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCD1