The domain within your query sequence starts at position 155 and ends at position 317; the E-value for the NCD2 domain shown below is 3.2e-68.

SDSRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTLPKSDL
SEVKELLKNNKKLAKMIGHIFEMSDEDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELT
VNEAAAQLCVKDNALLTRRDELFALARQVSREVTYKYTYRTTR

NCD2

NCD2
PFAM accession number:PF04905
Interpro abstract (IPR006989):

Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [ (PUBMED:9418898) ]. This entry represents a NAB domain 2 of the protein. It is necessary for transcriptional repression by the Nab proteins [ (PUBMED:9418898) ]. It is also required for transcription activation by Nab proteins at Nab-activated promoters [ (PUBMED:10734128) ].

GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCD2