SMART: Pfam domain NCKAP5

The domain within your query sequence starts at position 1431 and ends at position 1733; the E-value for the NCKAP5 domain shown below is 5.3e-119.

LSPSIEEKVMLCIQENVEKGQVQTKSASVEVKPRAGPSFTSWFGFRKSRLPALSSRRMEA
SKSKVEKKDTKLKSERKKEKKKAEVQSKIENELSRGTKKADGQSPDDGLQSSESLKVSQD
IYNQMKLEPRNRPSPAVCPTKDAFMTELLNRVDKRASVQRESGSKGVSCRSVLEGTSQGS
CFASGSVSTQGSQKKNIKTKVDMEKPRESLGAEVNEDVQEDEEDRVADTTLQSHMIESNC
QMRTLDSGIGTFPLPDSGNRSVGRYICQQDSPEDTDALLPLQPAASMASSARAQTLDREV
PSS

NCKAP5

PFAM accession number:	PF15246
Interpro abstract (IPR032769):	This entry represents the C-terminal domain of the Nck-associated protein 5 (NCKAP5), also known as the Peripheral clock protein. NCKAP5 interacts with the SH3-containing region of the adaptor protein Nck. Nck is a protein that interacts with receptor tyrosine kinases and guanine nucleotide exchange factor Sos. The role of Nck can be thought of as similar to Grb2. The role of NCKAP5 is to assist Nck with its adaptor protein role [ (PUBMED:9344857) ].

PFAM accession number:

PF15246

Interpro abstract (IPR032769):

This entry represents the C-terminal domain of the Nck-associated protein 5 (NCKAP5), also known as the Peripheral clock protein. NCKAP5 interacts with the SH3-containing region of the adaptor protein Nck. Nck is a protein that interacts with receptor tyrosine kinases and guanine nucleotide exchange factor Sos. The role of Nck can be thought of as similar to Grb2. The role of NCKAP5 is to assist Nck with its adaptor protein role [ (PUBMED:9344857) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCKAP5