SMART: Pfam domain NDUFB10

The domain within your query sequence starts at position 54 and ends at position 149; the E-value for the NDUFB10 domain shown below is 7.1e-40.

DRPRFKVFSSAEFIERQHAKNRTYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKV
DQEIMNIIQERLKACQQREGENYQQNCAKELEQFTK

NDUFB10

PFAM accession number:	PF10249
Interpro abstract (IPR019377):	NADH-ubiquinone oxidoreductase subunit 10 of (NDUFB10) is a member of a family of conserved proteins of up to 180 residues. It is one of the 41 protein subunits within the hydrophobic fraction of the NADH:ubiquinone oxidoreductase (complex I), a multiprotein complex located in the inner mitochondrial membrane whose main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. NDUFB10 is encoded in the nucleus [ (PUBMED:27626371) (PUBMED:12837546) ].

PFAM accession number:

PF10249

Interpro abstract (IPR019377):

NADH-ubiquinone oxidoreductase subunit 10 of (NDUFB10) is a member of a family of conserved proteins of up to 180 residues. It is one of the 41 protein subunits within the hydrophobic fraction of the NADH:ubiquinone oxidoreductase (complex I), a multiprotein complex located in the inner mitochondrial membrane whose main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. NDUFB10 is encoded in the nucleus [ (PUBMED:27626371) (PUBMED:12837546) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUFB10