The domain within your query sequence starts at position 48 and ends at position 104; the E-value for the NDUF_B12 domain shown below is 1.3e-25.
RDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
NDUF_B12 |
 |
|---|
| PFAM accession number: | PF08122 |
|---|---|
| Interpro abstract (IPR012576): | This family represents an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain [ (PUBMED:12611891) ]. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. |
| GO process: | electron transport chain (GO:0022900) |
| GO component: | mitochondrion (GO:0005739) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B12