The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the NDUF_B6 domain shown below is 1.5e-22.

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNM
TK

NDUF_B6

NDUF_B6
PFAM accession number:PF09782
Interpro abstract (IPR019174):

The NADH dehydrogenase [ubiquinone] complex performs the first stage of electron transfer from NADH to the respiratory chain. This entry represents an accessory subunit that is not thought to be involved in catalysis [ (PUBMED:1518044) ].

GO process:mitochondrial electron transport, NADH to ubiquinone (GO:0006120)
GO component:mitochondrial respiratory chain complex I (GO:0005747)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B6