The domain within your query sequence starts at position 379 and ends at position 478; the E-value for the NFRKB_winged domain shown below is 4.5e-35.
FFSLLLEILLLESQASLPMLEDRVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGES RAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFHLW
NFRKB_winged |
 |
|---|
| PFAM accession number: | PF14465 |
|---|---|
| Interpro abstract (IPR025220): | This winged helix-like domain is found in nuclear factor related to kappa-B-binding (NFRKB) protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NFRKB_winged