The domain within your query sequence starts at position 81 and ends at position 170; the E-value for the NID domain shown below is 1.5e-31.
ALVTFEDPKVVDRLLQQKEHRVNLEDCRLRVQVQPLELPVVTNIQVSSQPDNHRVLVSGF PAGLRLSEEELLDKLEIFFGKAKNGGGDVE
NID |
 |
|---|
| PFAM accession number: | PF07292 |
|---|---|
| Interpro abstract (IPR009909): | This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi). This domain mediates Nmi-Nmi protein interactions and subcellular localisation [ (PUBMED:10950963) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NID