The domain within your query sequence starts at position 146 and ends at position 245; the E-value for the NIPSNAP domain shown below is 5.5e-29.

YELATFQMKPGGPALWGNAFKRAVNAHVELGYSTLVGVFHTEYGALNRVHVLWWNESADS
RAAGRHWSHEDPRVVAAVRESVSYLESQQNTFLIPTSFSP

NIPSNAP

NIPSNAP
PFAM accession number:PF07978
Interpro abstract (IPR012577):

Proteins containing this domain include many hypothetical proteins. It also includes members of the NIPSNAP family, which have putative roles in vesicular transport [ (PUBMED:9661659) ]. This domain is often found in duplicate.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NIPSNAP