SMART: Pfam domain NKAIN

The domain within your query sequence starts at position 1 and ends at position 206; the E-value for the NKAIN domain shown below is 1.5e-93.

MGKCSGRCTLVAFCCLQLVAALQRQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSR
YLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPV
LNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDF
IGGFDSYGYQAPQKTSHLQLQPLYTS

NKAIN

PFAM accession number:	PF05640
Interpro abstract (IPR008516):	NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [ (PUBMED:17606467) ].

PFAM accession number:

PF05640

Interpro abstract (IPR008516):

NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [ (PUBMED:17606467) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NKAIN