The domain within your query sequence starts at position 124 and ends at position 283; the E-value for the NMT domain shown below is 2e-84.

HGAIEPDKDNIRQEPYSLPQGFMWDTLDLSNAEVLKELYTLLNENYVEDDDNMFRFDYSP
EFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKRMVEINFLCVHKKL
RSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVATC

NMT

NMT
PFAM accession number:PF01233
Interpro abstract (IPR022676):

Myristoyl-CoA:protein N-myristoyltransferase ( EC 2.3.1.97 ) (Nmt) [ (PUBMED:8322618) ] is the enzyme responsible for transferring a myristate group on the N-terminal glycine of a number of cellular eukaryotics and viral proteins. Nmt is a monomeric protein of about 50 to 60kDa whose sequence appears to be well conserved.

The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold. This entry represents the N-terminal region.

GO function:glycylpeptide N-tetradecanoyltransferase activity (GO:0004379)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NMT