The domain within your query sequence starts at position 251 and ends at position 323; the E-value for the NOB1_Zn_bind domain shown below is 1e-34.
VREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNP RGLRYSLPTPKGG
NOB1_Zn_bind |
---|
PFAM accession number: | PF08772 |
---|---|
Interpro abstract (IPR014881): | This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOB1_Zn_bind