The domain within your query sequence starts at position 14 and ends at position 79; the E-value for the NOP5NT domain shown below is 3.8e-22.
HVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENA NAVSEG
NOP5NT |
---|
PFAM accession number: | PF08156 |
---|---|
Interpro abstract (IPR012974): | This N-terminal domain is found in RNA-binding proteins of the NOP5 family [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOP5NT