The domain within your query sequence starts at position 24 and ends at position 114; the E-value for the NPFF domain shown below is 3.1e-32.
AGSWGEDQVFAGEDKGPHPPQYAHIPDRIQTPGSLFRVLLQAMDTPRRSPAFLFQPQRFG RSAWGSWSKEQLNPQARQFWSLAAPQRFGKK
NPFF |
 |
|---|
| PFAM accession number: | PF15085 |
|---|---|
| Interpro abstract (IPR008065): | Neuropeptide FF (together with neuropeptides AF and SF, which are derived from the same precursor) belongs to a family of neuropeptides containing an RF-amide motif at their C-termini [ (PUBMED:11325803) ]. Neuropeptide FF is found at high concentrations in the posterior pituitary, spinal cord, hypothalamus and medulla, and is believed to be involved in pain modulation, opioid tolerance, cardiovascular regulation, memory and neuroendocrine regulation. |
| GO function: | signaling receptor binding (GO:0005102), neuropeptide hormone activity (GO:0005184) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPFF