The domain within your query sequence starts at position 8 and ends at position 72; the E-value for the NPR3 domain shown below is 2.7e-14.
ISVILANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADACAH LVWYG
NPR3 |
![]() |
---|
PFAM accession number: | PF03666 |
---|---|
Interpro abstract (IPR005365): | In budding yeasts, Npr3 forms a complex with NPR2. This complex heterodimer is responsible for inactivating TORC1, an evolutionarily conserved protein complex that controls cell size via nutritional input signals, specifically, in response to amino acid starvation [ (PUBMED:19521502) ]. In humans, Npr3 like protein, NPRL3, is part of the GATOR1 complex that functions as an inhibitor of the amino acid-sensing branch of the TORC1 pathway [ (PUBMED:23723238) ]. |
GO process: | negative regulation of TOR signaling (GO:0032007), cellular response to amino acid starvation (GO:0034198) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPR3