The domain within your query sequence starts at position 47 and ends at position 133; the E-value for the NRN1 domain shown below is 2.7e-42.
CDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDM WDKLRKESKNLNIQGSLFELCGSSNGA
NRN1 |
---|
PFAM accession number: | PF15056 |
---|---|
Interpro abstract (IPR026144): | This entry represents the neuritin family of proteins, including neuritin-A and B from Xenopus laevis and neuritin-like protein from human and mouse. Neuritin has been shown to promote neurite outgrowth and arborisation in primary embryonic hippocampal and cortical cultures [ (PUBMED:9122250) ]. Its expression is induced by neuronal activity and by the activity-regulated neurotrophins BDNF and NT-3 [ (PUBMED:9122250) ]. |
GO process: | nervous system development (GO:0007399) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NRN1