The domain within your query sequence starts at position 26 and ends at position 219; the E-value for the NT5C domain shown below is 2.9e-30.
RALRVLVDMDGVLADFEGGFLRKFRARFPDLPFVALEDRRGFWVSEQYGRLQPGLSEKAI SIWESKDFFFELEPLPGAVEAVKQMANLQNTDVFICTSPIKMFKYCPYEKYAWVEKHFGP DFLEQIVLTRDKTVISADLLIDDRPDITGAEPHPSWEHILFTSCHNYHLQLQPPRRRLHS WADDWKAILDSKRL
NT5C |
---|
PFAM accession number: | PF06941 |
---|---|
Interpro abstract (IPR010708): | This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins. 5'(3')-deoxyribonucleotidase is a ubiquitous enzyme in mammalian cells whose physiological function is not known [ (PUBMED:10681516) ]. |
GO process: | deoxyribonucleotide catabolic process (GO:0009264) |
GO function: | 5'-nucleotidase activity (GO:0008253) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NT5C