The domain within your query sequence starts at position 4 and ends at position 71; the E-value for the NTP_transf_3 domain shown below is 1.9e-9.
AVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDE ALTQFLEA
NTP_transf_3 |
---|
PFAM accession number: | PF12804 |
---|---|
Interpro abstract (IPR025877): | This entry represents a wide range of NTP transferase domains, including the NTP transferase domain of MobA protein (Molybdopterin-guanine dinucleotide biosynthesis protein A). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTP_transf_3