The domain within your query sequence starts at position 424 and ends at position 490; the E-value for the NUC202 domain shown below is 8.6e-30.
PYSTIRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLCSTRGSS DGGLQSG
NUC202 |
 |
|---|
| PFAM accession number: | PF08166 |
|---|---|
| Interpro abstract (IPR012980): | This domain is found in a novel family of nucleolar proteins [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC202