The domain within your query sequence starts at position 147 and ends at position 277; the E-value for the NUDIX-like domain shown below is 2.4e-9.
TTVYLLFSDLNPLVTLGGNKESSQQPEVRLCQLNYPDVKGYLAQPEKITLVFLGVELEMR KGSPAQAGGVPEEEEDGLVAWFALGIEPGAAEEFKQRHENCYFLHPPMPALLQLKEKEAG VVAQARSVLAW
NUDIX-like |
---|
PFAM accession number: | PF09296 |
---|---|
Interpro abstract (IPR015375): | This entry represents the N-terminal domain found in NADH pyrophosphatase. Nitrate reductase inactivator (NRI) protein shares 51.1-68.3% of its amino acid sequence with three types of the nucleotide pyrophosphatase-like protein from Arabidopsis thaliana. |
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDIX-like