The domain within your query sequence starts at position 35 and ends at position 222; the E-value for the NUDIX_2 domain shown below is 9.9e-85.

RTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHV
LLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFE
PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISS
LPQLLSRF

NUDIX_2

• PFAM accession number: PF13869
• Interpro abstract (IPR016706):

  This entry represents cleavage and polyadenylation specificity factor subunit 5, also known as the cleavage and polyadenylation specificity factor 25kDa subunit. These proteins are a component of the cleavage factor Im (CFIm) complex involved in pre-mRNA 3' end processing [ (PUBMED:9659921) ]. CFIm may also play a role in regulation of poly(A) site selection [ (PUBMED:20695905) ].

• GO process: mRNA polyadenylation (GO:0006378)
• GO component: mRNA cleavage factor complex (GO:0005849)
• GO function: mRNA binding (GO:0003729)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDIX_2