The domain within your query sequence starts at position 86 and ends at position 229; the E-value for the Na_Ca_ex domain shown below is 2.4e-31.

HILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVF
ITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIY
DEEIVWWEGLVLIILYVFYILIMK

Na_Ca_ex

 Na_Ca_ex
PFAM accession number:PF01699
Interpro abstract (IPR004837):

The sodium/calcium exchangers are a family of integral membrane proteins. This domain covers the integral membrane regions of these proteins. Sodium/calcium exchangers regulate intracellular Ca2+ concentrations in many cells; cardiac myocytes, epithelial cells, neurons retinal rod photoreceptors and smooth muscle cells [ (PUBMED:1700476) ]. Ca2+ is moved into or out of the cytosol depending on Na+ concentration [ (PUBMED:1700476) ]. In humans and rats there are 3 isoforms; NCX1 NCX2 and NCX3 [ (PUBMED:8798769) ].

GO process:transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_Ca_ex