The domain within your query sequence starts at position 1 and ends at position 132; the E-value for the Na_K-ATPase domain shown below is 2.7e-48.
MLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSA QKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCI IIKLNRVLGFKP
Na_K-ATPase |
---|
PFAM accession number: | PF00287 |
---|---|
Interpro abstract (IPR000402): | This entry represents the sodium/potassium-transporting ATPase subunit beta. This is the non-catalytic component of the active enzyme, which catalyses the hydrolysis of ATP coupled with the exchange of Na + and K + ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane [ (PUBMED:9648860) ]. |
GO process: | sodium ion transport (GO:0006814), potassium ion transport (GO:0006813) |
GO component: | sodium:potassium-exchanging ATPase complex (GO:0005890) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_K-ATPase