The domain within your query sequence starts at position 6 and ends at position 102; the E-value for the Na_sulph_symp domain shown below is 7.9e-20.

TCVTKFKSFAILLFTPILMLPLVILIPDKVLDSKQVCIQYMKDTNMLFLGSLIVAVAVER
WKLHKRVALRMLLFVGTKPSRLMLGFMFVTAFLSMWI

Na_sulph_symp

Na_sulph_symp
PFAM accession number:PF00939
Interpro abstract (IPR001898):

Integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. The SLC13 family consists mainly of dicarboxylate and sulfate transporters [ (PUBMED:16211368) (PUBMED:23506872) ], and includes of the following proteins:

  • Mammalian sodium/sulphate cotransporter [ (PUBMED:7690140) ].
  • Mammalian renal sodium/dicarboxylate cotransporter [ (PUBMED:8967342) ], which transports succinate and citrate.
  • Mammalian intestinal sodium/dicarboxylate cotransporter.
  • Chlamydomonas reinhardtii putative sulphur deprivation response regulator SAC1 [ (PUBMED:8641280) ].

These transporters are proteins of from 430 to 620 amino acids which are highly hydrophobic and which probably contain about 12 transmembrane regions.

GO process:transmembrane transport (GO:0055085)
GO component:membrane (GO:0016020)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_sulph_symp