The domain within your query sequence starts at position 321 and ends at position 485; the E-value for the Nab1 domain shown below is 9.2e-101.

GERDELSPKRIKIEDGFPDFQESVPTLFQQARAKSEELAGLGSQAEKGMAKQMELLCAQA
GYERLQQERRLTAGLYRQSSGEQSPDGGLPSDSSDGQGERPLNLRIPSVQNRQPHHFVVD
GELSRLYSSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR

Nab1

 Nab1
PFAM accession number:PF04902
Interpro abstract (IPR006986):

Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [ (PUBMED:9418898) ]. This C-terminal region is found only in the Nab1 subfamily.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:transcription coregulator activity (GO:0003712)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nab1