The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the Ndufs5 domain shown below is 9.5e-55.
MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEF DDFEECLLRYKTMRRMHDIKKQREKLMKEGK
Ndufs5 |
---|
PFAM accession number: | PF10200 |
---|---|
Interpro abstract (IPR019342): | Proteins in this entry form part of the NADH:ubiquinone oxidoreductase complex I. Complex I is the first multisubunit inner membrane protein complex of the mitochondrial electron transport chain and it transfers two electrons from NADH to ubiquinone. The mammalian complex I is composed of 45 different subunits. The proteins in this entry represent a component of the iron-sulphur (IP) fragment of the enzyme, that is not involved in catalysis. These proteins carry four highly conserved cysteine residues, but these do not appear to be in a configuration which would favour metal binding, so the exact function of the protein is uncertain [ (PUBMED:10070614) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ndufs5