The domain within your query sequence starts at position 1 and ends at position 96; the E-value for the Ndufs5 domain shown below is 1.1e-60.

MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEF
DDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPP

Ndufs5

Ndufs5
PFAM accession number:PF10200
Interpro abstract (IPR019342):

Proteins in this entry form part of the NADH:ubiquinone oxidoreductase complex I. Complex I is the first multisubunit inner membrane protein complex of the mitochondrial electron transport chain and it transfers two electrons from NADH to ubiquinone. The mammalian complex I is composed of 45 different subunits. The proteins in this entry represent a component of the iron-sulphur (IP) fragment of the enzyme, that is not involved in catalysis. These proteins carry four highly conserved cysteine residues, but these do not appear to be in a configuration which would favour metal binding, so the exact function of the protein is uncertain [ (PUBMED:10070614) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ndufs5