SMART: Pfam domain NeuB

The domain within your query sequence starts at position 39 and ends at position 278; the E-value for the NeuB domain shown below is 4.7e-81.

MIRTAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYKEL
QSYAQEIGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSG
MQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDANLRVISEYQKLFPDIPIGYSGHE
TGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTK

NeuB

PFAM accession number:	PF03102
Interpro abstract (IPR013132):	NeuB is the prokaryotic N-acetylneuraminic acid synthase. It catalyses the direct formation of N-acetylneuraminic acid (Neu5Ac), the most common sialic acid, by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). Mammals synthesise the 9-phosphate form, Neu5Ac-9-P, and utilise ManNAc-6-P instead of ManNAc [ (PUBMED:10749855) (PUBMED:10873658) (PUBMED:15888312) ]. The bacterial and mammalian enzymes share 30%-40% sequence identity and are composed of two distinct domains. The N-terminal domain (NeuB domain) consists of ~250 amino acid residues, and is considered to bind the sugar substrates. The C-terminal domain consists of ~75 amino acid residues, and is called the antifreeze-like (AFL) domain, since it is similar to those observed in a variety of functional type III antifreeze proteins (AFPs) [ (PUBMED:15516336) ]. This entry represents the N-terminal domain.
GO process:	carbohydrate biosynthetic process (GO:0016051)

PFAM accession number:

PF03102

Interpro abstract (IPR013132):

NeuB is the prokaryotic N-acetylneuraminic acid synthase. It catalyses the direct formation of N-acetylneuraminic acid (Neu5Ac), the most common sialic acid, by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). Mammals synthesise the 9-phosphate form, Neu5Ac-9-P, and utilise ManNAc-6-P instead of ManNAc [ (PUBMED:10749855) (PUBMED:10873658) (PUBMED:15888312) ]. The bacterial and mammalian enzymes share 30%-40% sequence identity and are composed of two distinct domains. The N-terminal domain (NeuB domain) consists of ~250 amino acid residues, and is considered to bind the sugar substrates. The C-terminal domain consists of ~75 amino acid residues, and is called the antifreeze-like (AFL) domain, since it is similar to those observed in a variety of functional type III antifreeze proteins (AFPs) [ (PUBMED:15516336) ].

This entry represents the N-terminal domain.

GO process:

carbohydrate biosynthetic process (GO:0016051)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NeuB