The domain within your query sequence starts at position 73 and ends at position 293; the E-value for the Neugrin domain shown below is 1.2e-99.
MEAPGAPPRTLTWEAMEQIRYLHKEFAESWSVPRLAEGFDVSTDVIRRVLKSKFVPTLEQ KLRQDQKVLKKAGFTREIGQLPVSEDTLKALSAGRSVSGLLMAGDEVSSKSQNHSTALKV AKSHPHSTDAQKKREGRDKRIQVLEESLVPATTALGHQRELQKSATSDSEATGRAGSDTL PSAVLLEELKPGEPGDQSFSSKVVQRGHDFFDSNGNFLYRI
Neugrin |
---|
PFAM accession number: | PF06413 |
---|---|
Interpro abstract (IPR010487): | This entry include neugrin from mammals and Rrg9 from fungi. Neugrin is mainly expressed in neurons and may play an important role in the process of neuronal differentiation [ (PUBMED:11118320) ]. Rrg9 is required for respiratory activity and maintenance and expression of the mitochondrial genome [ (PUBMED:19751518) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neugrin