The domain within your query sequence starts at position 26 and ends at position 231; the E-value for the Neur_chan_LBD domain shown below is 3.2e-70.
EEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWT DYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSIQWLPP AIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEWDIVAL PGRRTVNPQDPSYVDVTYDFIIKRKP
Neur_chan_LBD |
![]() |
---|
PFAM accession number: | PF02931 |
---|---|
Interpro abstract (IPR006202): | Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [ (PUBMED:1721053) (PUBMED:1846404) ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:
These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [ (PUBMED:1721053) (PUBMED:1846404) ]. This entry presents the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. |
GO process: | ion transport (GO:0006811) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | extracellular ligand-gated ion channel activity (GO:0005230) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neur_chan_LBD