The domain within your query sequence starts at position 35 and ends at position 239; the E-value for the Neur_chan_LBD domain shown below is 2.3e-75.

EDALLRHLFQGYQKCVRPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQ
KLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMTKAIVKSSGTVSWTPPAS
YKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKG
MKGNRREGFYSYPFVTYSFVLRRLP

Neur_chan_LBD

Neur_chan_LBD
PFAM accession number:PF02931
Interpro abstract (IPR006202):

Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [ (PUBMED:1721053) (PUBMED:1846404) ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:

  • Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits [ (PUBMED:18446614) ].
  • Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits [ (PUBMED:15383648) ].
  • Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known [ (PUBMED:18760291) ].
  • Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) [ (PUBMED:10026168) ].
  • Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [ (PUBMED:15165736) ].

These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [ (PUBMED:1721053) (PUBMED:1846404) ].

This entry presents the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.

GO process:ion transport (GO:0006811)
GO component:integral component of membrane (GO:0016021)
GO function:extracellular ligand-gated ion channel activity (GO:0005230)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neur_chan_LBD