The domain within your query sequence starts at position 61 and ends at position 271; the E-value for the Neurexophilin domain shown below is 2.5e-115.
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG
Neurexophilin |
---|
PFAM accession number: | PF06312 |
---|---|
Interpro abstract (IPR026845): | This entry includes neurexophilin and NXPE proteins. Neurexophilins form a family of related glycoproteins that are proteolytically processed after synthesis and bind to alpha-neurexins. The structure and characteristics of neurexophilins indicate that they function as neuropeptides that may signal via alpha-neurexins [ (PUBMED:9570794) ]. NXPE is a glycoprotein with unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neurexophilin