The domain within your query sequence starts at position 146 and ends at position 263; the E-value for the Neuro_bHLH domain shown below is 1.3e-41.
GQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSTLLEKHEEKSSICDSTISVHSFNYQ SPGLPSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFS
Neuro_bHLH |
---|
PFAM accession number: | PF12533 |
---|---|
Interpro abstract (IPR022575): | This functionally uncharacterised domain is found in eukaryotes, and is approximately 80 amino acids in length. There is a single completely conserved residue W that may be functionally important. It is found in neurogenic differentiation factors which are essential for neurogenesis. It is found C-terminal to the helix-loop-helix DNA binding domain . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuro_bHLH