The domain within your query sequence starts at position 24 and ends at position 88; the E-value for the Neuropeptide_S domain shown below is 1.3e-40.

YPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTS
FRRAK

Neuropeptide_S

Neuropeptide_S
PFAM accession number:PF14993
Interpro abstract (IPR028138):

Neuropeptide S (NPS) is a bioactive peptide that may be involved in several biological processes, including food intake, locomotion, wakefulness, arousal, and anxiety. NPS activates its cognate G protein-coupled receptor (NPSR1) at low nanomolar agonist concentrations and induces elevation of intracellular Ca2+ and cAMP [ (PUBMED:15312648) (PUBMED:15919054) (PUBMED:17613937) ].

GO process:neuropeptide signaling pathway (GO:0007218)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuropeptide_S