The domain within your query sequence starts at position 24 and ends at position 88; the E-value for the Neuropeptide_S domain shown below is 1.3e-40.
YPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTS FRRAK
Neuropeptide_S |
---|
PFAM accession number: | PF14993 |
---|---|
Interpro abstract (IPR028138): | Neuropeptide S (NPS) is a bioactive peptide that may be involved in several biological processes, including food intake, locomotion, wakefulness, arousal, and anxiety. NPS activates its cognate G protein-coupled receptor (NPSR1) at low nanomolar agonist concentrations and induces elevation of intracellular Ca2+ and cAMP [ (PUBMED:15312648) (PUBMED:15919054) (PUBMED:17613937) ]. |
GO process: | neuropeptide signaling pathway (GO:0007218) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuropeptide_S