The domain within your query sequence starts at position 847 and ends at position 953; the E-value for the Nexin_C domain shown below is 1e-28.
WVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRS VAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETK
Nexin_C |
---|
PFAM accession number: | PF08628 |
---|---|
Interpro abstract (IPR013937): | This region is found at the C terminus of proteins belonging to the nexin family. It is found on proteins which also contain IPR001683 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nexin_C