The domain within your query sequence starts at position 14 and ends at position 117; the E-value for the Ninjurin domain shown below is 4.9e-36.
DLNFYATKKSVAESMLDVALFMSNAMRLKSVLQQGPFAEYYTTLVTLIIVSLLLQVVISL LLVFIAILNLNEVENQRHLNKLNNAATILVFITVVINIFITAFG
Ninjurin |
---|
PFAM accession number: | PF04923 |
---|---|
Interpro abstract (IPR007007): | Ninjurin (nerve injury-induced protein) is involved in nerve regeneration and in the formation of some tissues [ (PUBMED:8780658) ]. |
GO process: | cell adhesion (GO:0007155), tissue regeneration (GO:0042246) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ninjurin