The domain within your query sequence starts at position 37 and ends at position 109; the E-value for the Ninjurin domain shown below is 4.5e-26.
NVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGV LLIFLATSTQARL
Ninjurin |
 |
|---|
| PFAM accession number: | PF04923 |
|---|---|
| Interpro abstract (IPR007007): | Ninjurin (nerve injury-induced protein) is involved in nerve regeneration and in the formation of some tissues [ (PUBMED:8780658) ]. |
| GO process: | cell adhesion (GO:0007155), tissue regeneration (GO:0042246) |
| GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ninjurin