The domain within your query sequence starts at position 19 and ends at position 118; the E-value for the Noelin-1 domain shown below is 3.8e-44.
QSPEEGWQLYTSAQAPDGKCVCTAVIPAQSTCARDGRSRELRQLMEKVQNVSQSMEVLEL RTFRDLQYVRSMETLMRSLDARLRAADGSVSAKSFQELKD
Noelin-1 |
![]() |
---|
PFAM accession number: | PF12308 |
---|---|
Interpro abstract (IPR022082): | This domain is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with . There are two conserved sequence motifs: SAQ and VQN. It is found in Noelin, a glycoprotein which is secreted mainly by postmitotic neurogenic tissues in the developing central and peripheral nervous systems, first appearing after neural tube closure [ (PUBMED:11784068) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Noelin-1