The domain within your query sequence starts at position 45 and ends at position 83; the E-value for the Nop25 domain shown below is 5.2e-15.

HTGPREYLTGFHKRKVERKKAAIEEIKQRLKQEQKKLRE

Nop25

Nop25
PFAM accession number:PF09805
Interpro abstract (IPR019186):

Nop12 is a novel nucleolar protein required for pre-large subunit rRNA processing and in yeast normal rates of cell growth at low temperatures [ (PUBMED:11452019) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop25